Lineage for d1srqb_ (1srq B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020576Fold e.55: Rap/Ran-GAP [111346] (1 superfamily)
    consists of two domains; d1: alpha+beta (78-190; alpha-beta(4)-alpha-beta-alpha; 3 layers; antiparallel beta-sheet of 5 strands; order 51234); d2: alpha/beta similar to the G-domain fold (191-381; (52592))
  4. 3020577Superfamily e.55.1: Rap/Ran-GAP [111347] (1 family) (S)
  5. 3020578Family e.55.1.1: Rap/Ran-GAP [111348] (1 protein)
    Pfam PF02145
  6. 3020579Protein Rap1 GTPase-activating protein 1, Rap1GAP [111349] (1 species)
  7. 3020580Species Human (Homo sapiens) [TaxId:9606] [111350] (1 PDB entry)
    Uniprot P47736
  8. 3020582Domain d1srqb_: 1srq B: [105968]
    chain D is disordered in the crystal
    complexed with mpd, so4

Details for d1srqb_

PDB Entry: 1srq (more details), 2.9 Å

PDB Description: Crystal Structure of the Rap1GAP catalytic domain
PDB Compounds: (B:) GTPase-activating protein 1

SCOPe Domain Sequences for d1srqb_:

Sequence, based on SEQRES records: (download)

>d1srqb_ e.55.1.1 (B:) Rap1 GTPase-activating protein 1, Rap1GAP {Human (Homo sapiens) [TaxId: 9606]}
vklecnptariyrkhflgkehfnyysldtalghlvfslkydvigdqehlrlllrtkcrty
hdvipiscltefpnvvqmaklvcedvnvdrfypvlypkasrlivtfdehvisnnfkfgvi
yqklgqtseeelfstneespafvefleflgqkvklqdfkgfrggldvthgqtgtesvycn
frnkeimfhvstklpytegdaqqlqrkrhigndivavvfqdentpfvpdmiasnflhayv
vvqaegggpdgplykvsvtarddvpffgpplpdpavfrkgpefqeflltklinaeyacyk
aekfakleertraalletlyeelhihsqsmmgl

Sequence, based on observed residues (ATOM records): (download)

>d1srqb_ e.55.1.1 (B:) Rap1 GTPase-activating protein 1, Rap1GAP {Human (Homo sapiens) [TaxId: 9606]}
vklecnptariyrkhflgkehfnyysldtalghlvfslkydvigdqehlrlllrtkcrty
hdvipisfpnvvqmaklvcedvnvdrfypvlypkasrlivtfdehvisnnfkfgviyqkl
gqtseeelfstneespafvefleflgqkvkfrggtgtesvycnfrnkeimfhvstklpyt
aqqlqrkrhigndivavvfqdentpfvpdmiasnflhayvvvqaykvsvtarddvpffgp
plpdpavfrkgpefqeflltklinaeyacykaekfakleertraalletlyeelhihsqs
mmgl

SCOPe Domain Coordinates for d1srqb_:

Click to download the PDB-style file with coordinates for d1srqb_.
(The format of our PDB-style files is described here.)

Timeline for d1srqb_: