Lineage for d1sr9b2 (1sr9 B:61-370)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098241Family c.1.10.5: HMGL-like [89494] (3 proteins)
    Pfam PF00682
  6. 2098242Protein 2-isopropylmalate synthase LeuA, catalytic domain [110364] (1 species)
  7. 2098243Species Mycobacterium tuberculosis [TaxId:1773] [110365] (1 PDB entry)
    Uniprot P96420
  8. 2098245Domain d1sr9b2: 1sr9 B:61-370 [105964]
    Other proteins in same PDB: d1sr9a1, d1sr9a3, d1sr9b1, d1sr9b3
    complexed with cl, kiv, zn

Details for d1sr9b2

PDB Entry: 1sr9 (more details), 2 Å

PDB Description: crystal structure of leua from mycobacterium tuberculosis
PDB Compounds: (B:) 2-isopropylmalate synthase

SCOPe Domain Sequences for d1sr9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr9b2 c.1.10.5 (B:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
rtwpdrvidraplwcavdlrdgnqalidpmsparkrrmfdllvrmgykeievgfpsasqt
dfdfvreiieqgaipddvtiqvltqcrpeliertfqacsgapraivhfynstsilqrrvv
franraevqaiatdgarkcveqaakypgtqwrfeyspesytgteleyakqvcdavgevia
ptperpiifnlpatvemttpnvyadsiewmsrnlanresvilslhphndrgtavaaaelg
faagadriegclfgngertgnvclvtlglnlfsrgvdpqidfsnideirrtveycnqlpv
herhpyggdl

SCOPe Domain Coordinates for d1sr9b2:

Click to download the PDB-style file with coordinates for d1sr9b2.
(The format of our PDB-style files is described here.)

Timeline for d1sr9b2: