Lineage for d1sr9b2 (1sr9 B:61-370)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475345Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 475803Family c.1.10.5: HMGL-like (Pfam 00682) [89494] (3 proteins)
  6. 475804Protein 2-isopropylmalate synthase LeuA, catalytic domain [110364] (1 species)
  7. 475805Species Mycobacterium tuberculosis [TaxId:1773] [110365] (1 PDB entry)
  8. 475807Domain d1sr9b2: 1sr9 B:61-370 [105964]
    Other proteins in same PDB: d1sr9a1, d1sr9a3, d1sr9b1, d1sr9b3

Details for d1sr9b2

PDB Entry: 1sr9 (more details), 2 Å

PDB Description: crystal structure of leua from mycobacterium tuberculosis

SCOP Domain Sequences for d1sr9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr9b2 c.1.10.5 (B:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis}
rtwpdrvidraplwcavdlrdgnqalidpmsparkrrmfdllvrmgykeievgfpsasqt
dfdfvreiieqgaipddvtiqvltqcrpeliertfqacsgapraivhfynstsilqrrvv
franraevqaiatdgarkcveqaakypgtqwrfeyspesytgteleyakqvcdavgevia
ptperpiifnlpatvemttpnvyadsiewmsrnlanresvilslhphndrgtavaaaelg
faagadriegclfgngertgnvclvtlglnlfsrgvdpqidfsnideirrtveycnqlpv
herhpyggdl

SCOP Domain Coordinates for d1sr9b2:

Click to download the PDB-style file with coordinates for d1sr9b2.
(The format of our PDB-style files is described here.)

Timeline for d1sr9b2: