Lineage for d1sr9b1 (1sr9 B:437-491)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985344Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1985617Superfamily a.5.7: post-HMGL domain-like [89000] (3 families) (S)
  5. 1985618Family a.5.7.1: DmpG/LeuA communication domain-like [89001] (2 proteins)
  6. 1985619Protein 2-isopropylmalate synthase LeuA, communication domain [109723] (1 species)
  7. 1985620Species Mycobacterium tuberculosis [TaxId:1773] [109724] (1 PDB entry)
    Uniprot P96420
  8. 1985622Domain d1sr9b1: 1sr9 B:437-491 [105963]
    Other proteins in same PDB: d1sr9a2, d1sr9a3, d1sr9b2, d1sr9b3
    complexed with cl, kiv, zn

Details for d1sr9b1

PDB Entry: 1sr9 (more details), 2 Å

PDB Description: crystal structure of leua from mycobacterium tuberculosis
PDB Compounds: (B:) 2-isopropylmalate synthase

SCOPe Domain Sequences for d1sr9b1:

Sequence, based on SEQRES records: (download)

>d1sr9b1 a.5.7.1 (B:437-491) 2-isopropylmalate synthase LeuA, communication domain {Mycobacterium tuberculosis [TaxId: 1773]}
vayimktdhglslprrlqiefsqviqkiaegtageggevspkemwdafaeeylap

Sequence, based on observed residues (ATOM records): (download)

>d1sr9b1 a.5.7.1 (B:437-491) 2-isopropylmalate synthase LeuA, communication domain {Mycobacterium tuberculosis [TaxId: 1773]}
vayimktdhglslprrlqiefsqviqkvspkemwdafaeeylap

SCOPe Domain Coordinates for d1sr9b1:

Click to download the PDB-style file with coordinates for d1sr9b1.
(The format of our PDB-style files is described here.)

Timeline for d1sr9b1: