Lineage for d1sr8a_ (1sr8 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626148Fold e.54: CbiD-like [111341] (1 superfamily)
    2 domains; (1) alpha+beta (res 1-192), a circularly permuted rS5 domain 2-like fold (54210); (2) alpha/beta with parallel beta-sheet of 4 strands, order 2134
  4. 2626149Superfamily e.54.1: CbiD-like [111342] (1 family) (S)
    automatically mapped to Pfam PF01888
  5. 2626150Family e.54.1.1: CbiD-like [111343] (1 protein)
    Pfam PF01888
  6. 2626151Protein Cobalamin biosynthesis protein CbiD [111344] (1 species)
  7. 2626152Species Archaeoglobus fulgidus [TaxId:2234] [111345] (1 PDB entry)
    Uniprot O29535
  8. 2626153Domain d1sr8a_: 1sr8 A: [105959]

Details for d1sr8a_

PDB Entry: 1sr8 (more details), 1.9 Å

PDB Description: Structural Genomics, 1.9A crystal structure of cobalamin biosynthesis protein (cbiD) from Archaeoglobus fulgidus
PDB Compounds: (A:) cobalamin biosynthesis protein (cbiD)

SCOPe Domain Sequences for d1sr8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr8a_ e.54.1.1 (A:) Cobalamin biosynthesis protein CbiD {Archaeoglobus fulgidus [TaxId: 2234]}
mlidpielyrypekwikdrdaekkvrsglyiltedgylrrgittgttasaaavaaiaslk
ekvekvkvstpagvdveveveaekgfarvrkfsgdhefdvtngiifeaevcetsgiffgr
gvgvkagekavsrsaklqilenfikasrefnfsggvrisvpdgeevakktgnekvgikgg
isilgttgfvepwckklvetklkiamqyhriaittgrkawlyarkkfpeyqpfvfgvhid
ealkhpgekiivgfpgllkiwagsrdrieerareegvrvvvi

SCOPe Domain Coordinates for d1sr8a_:

Click to download the PDB-style file with coordinates for d1sr8a_.
(The format of our PDB-style files is described here.)

Timeline for d1sr8a_: