![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.54: CbiD-like [111341] (1 superfamily) 2 domains; (1) alpha+beta (res 1-192), a circularly permuted rS5 domain 2-like fold (54210); (2) alpha/beta with parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily e.54.1: CbiD-like [111342] (1 family) ![]() automatically mapped to Pfam PF01888 |
![]() | Family e.54.1.1: CbiD-like [111343] (1 protein) Pfam PF01888 |
![]() | Protein Cobalamin biosynthesis protein CbiD [111344] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [111345] (1 PDB entry) Uniprot O29535 |
![]() | Domain d1sr8a_: 1sr8 A: [105959] |
PDB Entry: 1sr8 (more details), 1.9 Å
SCOPe Domain Sequences for d1sr8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sr8a_ e.54.1.1 (A:) Cobalamin biosynthesis protein CbiD {Archaeoglobus fulgidus [TaxId: 2234]} mlidpielyrypekwikdrdaekkvrsglyiltedgylrrgittgttasaaavaaiaslk ekvekvkvstpagvdveveveaekgfarvrkfsgdhefdvtngiifeaevcetsgiffgr gvgvkagekavsrsaklqilenfikasrefnfsggvrisvpdgeevakktgnekvgikgg isilgttgfvepwckklvetklkiamqyhriaittgrkawlyarkkfpeyqpfvfgvhid ealkhpgekiivgfpgllkiwagsrdrieerareegvrvvvi
Timeline for d1sr8a_: