Lineage for d1sr7b_ (1sr7 B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448073Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 448074Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 448075Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (30 proteins)
  6. 448271Protein Progesterone receptor [48517] (1 species)
  7. 448272Species Human (Homo sapiens) [TaxId:9606] [48518] (4 PDB entries)
  8. 448276Domain d1sr7b_: 1sr7 B: [105958]

Details for d1sr7b_

PDB Entry: 1sr7 (more details), 1.46 Å

PDB Description: Progesterone Receptor Hormone Binding Domain with Bound Mometasone Furoate

SCOP Domain Sequences for d1sr7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr7b_ a.123.1.1 (B:) Progesterone receptor {Human (Homo sapiens)}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfh

SCOP Domain Coordinates for d1sr7b_:

Click to download the PDB-style file with coordinates for d1sr7b_.
(The format of our PDB-style files is described here.)

Timeline for d1sr7b_: