Lineage for d1sr7a_ (1sr7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009193Protein Progesterone receptor [48517] (1 species)
  7. 2009194Species Human (Homo sapiens) [TaxId:9606] [48518] (10 PDB entries)
    Uniprot P06401 679-932
  8. 2009197Domain d1sr7a_: 1sr7 A: [105957]
    complexed with gol, mof, so4

Details for d1sr7a_

PDB Entry: 1sr7 (more details), 1.46 Å

PDB Description: Progesterone Receptor Hormone Binding Domain with Bound Mometasone Furoate
PDB Compounds: (A:) progesterone receptor

SCOPe Domain Sequences for d1sr7a_:

Sequence, based on SEQRES records: (download)

>d1sr7a_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]}
qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
agmvkpllfhk

Sequence, based on observed residues (ATOM records): (download)

>d1sr7a_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]}
qlipplinllmsiepdviyaghdnpdtssslltslnqlgerqllsvvkwskslpgfrnlh
iddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmwq
ipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkgv
vsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkilag
mvkpllfhk

SCOPe Domain Coordinates for d1sr7a_:

Click to download the PDB-style file with coordinates for d1sr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1sr7a_: