SCOP 1.73: Domain d1sr6c_: 1sr6 C:

Lineage for d1sr6c_ (1sr6 C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Regulatory Chain [47527] (2 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (13 PDB entries)

8. Domain d1sr6c_: 1sr6 C: [105956]
   Other proteins in same PDB: d1sr6a1, d1sr6a2, d1sr6b_
   complexed with ca, mg, so4

Details for d1sr6c_

PDB Entry: 1sr6, 2.75 Å

PDB Description: Structure of nucleotide-free scallop myosin S1

PDB Compounds: (C:) myosin essential light chain, striated adductor muscle

SCOP Domain Sequences for d1sr6c_:

Sequence; same for both SEQRES and ATOM records:

>d1sr6c_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
dvdeiikltdlqedlegnvkyedfvkkvmagpypd

Timeline for d1sr6c_:

• d1sr6c_ first appeared in SCOP 1.69
  
• d1sr6c_ appears in SCOP 1.71
  
• d1sr6c_ appears in SCOP 1.75
  
• d1sr6c_ appears in the current release, SCOPe 2.08