Lineage for d1sr6b_ (1sr6 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324205Protein Myosin Essential Chain [47524] (3 species)
  7. 2324206Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries)
    Uniprot P13543
  8. 2324212Domain d1sr6b_: 1sr6 B: [105955]
    Other proteins in same PDB: d1sr6a1, d1sr6a2, d1sr6c_
    complexed with ca, mg, so4

Details for d1sr6b_

PDB Entry: 1sr6 (more details), 2.75 Å

PDB Description: Structure of nucleotide-free scallop myosin S1
PDB Compounds: (B:) myosin regulatory light chain, striated adductor muscle

SCOPe Domain Sequences for d1sr6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr6b_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
pveggkfdyvkftamikgsgeeea

SCOPe Domain Coordinates for d1sr6b_:

Click to download the PDB-style file with coordinates for d1sr6b_.
(The format of our PDB-style files is described here.)

Timeline for d1sr6b_: