| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Myosin Essential Chain [47524] (3 species) |
| Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries) Uniprot P13543 |
| Domain d1sr6b_: 1sr6 B: [105955] Other proteins in same PDB: d1sr6a1, d1sr6a2, d1sr6c_ complexed with ca, mg, so4 |
PDB Entry: 1sr6 (more details), 2.75 Å
SCOPe Domain Sequences for d1sr6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sr6b_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
pveggkfdyvkftamikgsgeeea
Timeline for d1sr6b_: