Lineage for d1sr6a1 (1sr6 A:29-76)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461512Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 461513Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 461514Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 461515Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries)
  8. 461519Domain d1sr6a1: 1sr6 A:29-76 [105953]
    Other proteins in same PDB: d1sr6a2, d1sr6b_, d1sr6c_

Details for d1sr6a1

PDB Entry: 1sr6 (more details), 2.75 Å

PDB Description: Structure of nucleotide-free scallop myosin S1

SCOP Domain Sequences for d1sr6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr6a1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOP Domain Coordinates for d1sr6a1:

Click to download the PDB-style file with coordinates for d1sr6a1.
(The format of our PDB-style files is described here.)

Timeline for d1sr6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sr6a2