Lineage for d1sr4c_ (1sr4 C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560566Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 560747Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 560748Family b.42.2.1: Ricin B-like [50371] (7 proteins)
  6. 560752Protein Cytolethal distending toxin subunit C [110209] (1 species)
  7. 560753Species Haemophilus ducreyi [TaxId:730] [110210] (1 PDB entry)
  8. 560754Domain d1sr4c_: 1sr4 C: [105950]
    Other proteins in same PDB: d1sr4a_, d1sr4b_
    complexed with br

Details for d1sr4c_

PDB Entry: 1sr4 (more details), 2 Å

PDB Description: Crystal Structure of the Haemophilus ducreyi cytolethal distending toxin

SCOP Domain Sequences for d1sr4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr4c_ b.42.2.1 (C:) Cytolethal distending toxin subunit C {Haemophilus ducreyi}
dpttypdvelsppprislrslltaqpvkndhydshnylsthwelidykgkeyeklrdggt
lvqfkvvgaakcfaflgkgttdckdtdhtvfnliptntgaflikdallgfcitshdfddl
klepcggsvsgrtfslayqwgilppfgpskilip

SCOP Domain Coordinates for d1sr4c_:

Click to download the PDB-style file with coordinates for d1sr4c_.
(The format of our PDB-style files is described here.)

Timeline for d1sr4c_: