Lineage for d1sr4b_ (1sr4 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548551Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2548552Protein Cytolethal distending toxin subunit B [111213] (3 species)
  7. 2548558Species Haemophilus ducreyi [TaxId:730] [111214] (1 PDB entry)
    Uniprot O06523 23-283
  8. 2548559Domain d1sr4b_: 1sr4 B: [105949]
    Other proteins in same PDB: d1sr4a_, d1sr4c_
    complexed with br

Details for d1sr4b_

PDB Entry: 1sr4 (more details), 2 Å

PDB Description: Crystal Structure of the Haemophilus ducreyi cytolethal distending toxin
PDB Compounds: (B:) cytolethal distending toxin protein B

SCOPe Domain Sequences for d1sr4b_:

Sequence, based on SEQRES records: (download)

>d1sr4b_ d.151.1.1 (B:) Cytolethal distending toxin subunit B {Haemophilus ducreyi [TaxId: 730]}
nlsdfkvatwnlqgssavneskwninvrqllsgeqgadilmvqeagslpssavrtsrviq
hggtpieeytwnlgtrsrpnmvyiyysrldvganrvnlaivsrrqadeafivhsdssvlq
srpavgirigtdvfftvhalatggsdavslirnifttfnsssspperrvyswmvvgdfnr
apanlevalrqepavsentiiiaptepthrsgnildyailhdahlprreqarerigaslm
lnqlrsqitsdhfpvsfvrdr

Sequence, based on observed residues (ATOM records): (download)

>d1sr4b_ d.151.1.1 (B:) Cytolethal distending toxin subunit B {Haemophilus ducreyi [TaxId: 730]}
nlsdfkvatwnlqgssavneskwninvrqllsgeqgadilmvqeagslpssavrtsrviq
hggtpieeytwnlgtrsrpnmvyiyysrldvganrvnlaivsrrqadeafivhsdssvlq
srpavgirigtdvfftvhalatggsdavslirnifttfnspperrvyswmvvgdfnrapa
nlevalrqepavsentiiiaptepthrsgnildyailhdahlprreqarerigaslmlnq
lrsqitsdhfpvsfvrdr

SCOPe Domain Coordinates for d1sr4b_:

Click to download the PDB-style file with coordinates for d1sr4b_.
(The format of our PDB-style files is described here.)

Timeline for d1sr4b_: