Lineage for d1sr4a_ (1sr4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792073Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2792100Protein Cytolethal distending toxin subunit A [110207] (2 species)
  7. 2792104Species Haemophilus ducreyi [TaxId:730] [110208] (1 PDB entry)
    Uniprot O06522 57-223
  8. 2792105Domain d1sr4a_: 1sr4 A: [105948]
    Other proteins in same PDB: d1sr4b_, d1sr4c_
    complexed with br

Details for d1sr4a_

PDB Entry: 1sr4 (more details), 2 Å

PDB Description: Crystal Structure of the Haemophilus ducreyi cytolethal distending toxin
PDB Compounds: (A:) Cytolethal distending toxin subunit A

SCOPe Domain Sequences for d1sr4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]}
lnllsssgpnrqvlpsepsnfmtlmgqngalltvwalakrnwlwaypniysqdfgnirnw
kmepgkhreyfrfvnqslgtcveaygnglihdicsldklaqefellptdsgavviksvsq
grcvtynpvsttfystvtlsvcdgatepsrdqtwylappvleatavn

SCOPe Domain Coordinates for d1sr4a_:

Click to download the PDB-style file with coordinates for d1sr4a_.
(The format of our PDB-style files is described here.)

Timeline for d1sr4a_: