Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Cytolethal distending toxin subunit A [110207] (2 species) |
Species Haemophilus ducreyi [TaxId:730] [110208] (1 PDB entry) Uniprot O06522 57-223 |
Domain d1sr4a_: 1sr4 A: [105948] Other proteins in same PDB: d1sr4b_, d1sr4c_ complexed with br |
PDB Entry: 1sr4 (more details), 2 Å
SCOPe Domain Sequences for d1sr4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} lnllsssgpnrqvlpsepsnfmtlmgqngalltvwalakrnwlwaypniysqdfgnirnw kmepgkhreyfrfvnqslgtcveaygnglihdicsldklaqefellptdsgavviksvsq grcvtynpvsttfystvtlsvcdgatepsrdqtwylappvleatavn
Timeline for d1sr4a_: