Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species) secreted during involution |
Species Sheep (Ovis aries) [TaxId:9940] [109621] (4 PDB entries) |
Domain d1sr0a2: 1sr0 A:240-307 [105947] Other proteins in same PDB: d1sr0a1 complexed with bma, nag |
PDB Entry: 1sr0 (more details), 3.05 Å
SCOP Domain Sequences for d1sr0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sr0a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat kgnqwvay
Timeline for d1sr0a2: