Lineage for d1sr0a2 (1sr0 A:240-307)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601019Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 601184Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 601185Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 601296Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 601308Species Sheep (Ovis aries) [TaxId:9940] [109621] (3 PDB entries)
  8. 601310Domain d1sr0a2: 1sr0 A:240-307 [105947]
    Other proteins in same PDB: d1sr0a1
    complexed with bma, nag

Details for d1sr0a2

PDB Entry: 1sr0 (more details), 3.05 Å

PDB Description: crystal structure of signalling protein from sheep(sps-40) at 3.0a resolution using crystal grown in the presence of polysaccharides

SCOP Domain Sequences for d1sr0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sr0a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries)}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOP Domain Coordinates for d1sr0a2:

Click to download the PDB-style file with coordinates for d1sr0a2.
(The format of our PDB-style files is described here.)

Timeline for d1sr0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sr0a1