Lineage for d1sr0a1 (1sr0 A:1-239,A:308-362)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) 
Family c.1.8.5: Type II chitinase [51534] (14 proteins)
glycosylase family 18
Protein Signal processing protein (SPC-40, MGP-40) [89480] (4 species)
secreted during involution
Species Sheep (Ovis aries) # [109611] (3 PDB entries) 
Domain d1sr0a1: 1sr0 A:1-239,A:308-362 [105946]
Other proteins in same PDB: d1sr0a2
Details for d1sr0a1
PDB Entry: 1sr0 (more details), 3.05 Å
PDB Description: crystal structure of signalling protein from sheep(sps-40) at 3.0a resolution using crystal grown in the presence of polysaccharides
SCOP Domain Sequences for d1sr0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sr0a1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) #}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlaev
SCOP Domain Coordinates for d1sr0a1:
Click to download the PDB-style file with coordinates for d1sr0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sr0a1:
- d1sr0a1 is new in SCOP 1.69
- d1sr0a1 appears in SCOP 1.71
- d1sr0a1 appears in the current release, SCOPe 2.08
View in 3D
