Lineage for d1sqnb_ (1sqn B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009193Protein Progesterone receptor [48517] (1 species)
  7. 2009194Species Human (Homo sapiens) [TaxId:9606] [48518] (10 PDB entries)
    Uniprot P06401 679-932
  8. 2009196Domain d1sqnb_: 1sqn B: [105945]
    complexed with ndr

Details for d1sqnb_

PDB Entry: 1sqn (more details), 1.45 Å

PDB Description: Progesterone Receptor Ligand Binding Domain with bound Norethindrone
PDB Compounds: (B:) progesterone receptor

SCOPe Domain Sequences for d1sqnb_:

Sequence, based on SEQRES records: (download)

>d1sqnb_ a.123.1.1 (B:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfhkk

Sequence, based on observed residues (ATOM records): (download)

>d1sqnb_ a.123.1.1 (B:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqgv
vsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkilag
mvkpllfhkk

SCOPe Domain Coordinates for d1sqnb_:

Click to download the PDB-style file with coordinates for d1sqnb_.
(The format of our PDB-style files is described here.)

Timeline for d1sqnb_: