Lineage for d1sqma2 (1sqm A:1-208)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2429865Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2429866Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2429867Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 2429883Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 2429884Species Human (Homo sapiens) [TaxId:9606] [63740] (57 PDB entries)
    Uniprot P09960
  8. 2429938Domain d1sqma2: 1sqm A:1-208 [105942]
    Other proteins in same PDB: d1sqma1, d1sqma3
    complexed with acy, imd, yb, zn

Details for d1sqma2

PDB Entry: 1sqm (more details), 2.3 Å

PDB Description: structure of [r563a] leukotriene a4 hydrolase
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d1sqma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqma2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
pedpsrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d1sqma2:

Click to download the PDB-style file with coordinates for d1sqma2.
(The format of our PDB-style files is described here.)

Timeline for d1sqma2: