Lineage for d1sqlm_ (1sql M:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 508755Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 508756Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 508911Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
  6. 508912Protein 7,8-dihydroneopterin aldolase [55629] (3 species)
  7. 508933Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111088] (1 PDB entry)
  8. 508946Domain d1sqlm_: 1sql M: [105937]

Details for d1sqlm_

PDB Entry: 1sql (more details), 2.2 Å

PDB Description: Crystal structure of 7,8-dihydroneopterin aldolase in complex with guanine

SCOP Domain Sequences for d1sqlm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqlm_ d.96.1.3 (M:) 7,8-dihydroneopterin aldolase {Thale cress (Arabidopsis thaliana)}
gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
nts

SCOP Domain Coordinates for d1sqlm_:

Click to download the PDB-style file with coordinates for d1sqlm_.
(The format of our PDB-style files is described here.)

Timeline for d1sqlm_: