Lineage for d1sqli_ (1sql I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966432Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
    automatically mapped to Pfam PF02152
  6. 2966433Protein 7,8-dihydroneopterin aldolase [55629] (4 species)
  7. 2966464Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111088] (1 PDB entry)
    Uniprot Q9SF23
  8. 2966473Domain d1sqli_: 1sql I: [105933]
    complexed with gun

Details for d1sqli_

PDB Entry: 1sql (more details), 2.2 Å

PDB Description: Crystal structure of 7,8-dihydroneopterin aldolase in complex with guanine
PDB Compounds: (I:) dihydroneopterin aldolase

SCOPe Domain Sequences for d1sqli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqli_ d.96.1.3 (I:) 7,8-dihydroneopterin aldolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
n

SCOPe Domain Coordinates for d1sqli_:

Click to download the PDB-style file with coordinates for d1sqli_.
(The format of our PDB-style files is described here.)

Timeline for d1sqli_: