Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins) beta-sheets of four subunits form a barrel, closed: n=16, S=16 automatically mapped to Pfam PF02152 |
Protein 7,8-dihydroneopterin aldolase [55629] (4 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111088] (1 PDB entry) Uniprot Q9SF23 |
Domain d1sqlc_: 1sql C: [105927] complexed with gun |
PDB Entry: 1sql (more details), 2.2 Å
SCOPe Domain Sequences for d1sqlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqlc_ d.96.1.3 (C:) 7,8-dihydroneopterin aldolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr nt
Timeline for d1sqlc_: