Lineage for d1sqlb_ (1sql B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
    automatically mapped to Pfam PF02152
  6. Protein 7,8-dihydroneopterin aldolase [55629] (4 species)
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111088] (1 PDB entry)
    Uniprot Q9SF23
  8. Domain d1sqlb_: 1sql B: [105926]
    complexed with gun

Details for d1sqlb_

PDB Entry: 1sql (more details), 2.2 Å

PDB Description: Crystal structure of 7,8-dihydroneopterin aldolase in complex with guanine
PDB Compounds: (B:) dihydroneopterin aldolase

SCOPe Domain Sequences for d1sqlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqlb_ d.96.1.3 (B:) 7,8-dihydroneopterin aldolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
n

SCOPe Domain Coordinates for d1sqlb_ are not available.

Timeline for d1sqlb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sqla_, d1sqlc_, d1sqld_, d1sqle_, d1sqlf_, d1sqlg_, d1sqlh_, d1sqli_, d1sqlj_, d1sqlk_, d1sqll_, d1sqlm_, d1sqln_, d1sqlo_, d1sqlp_