Lineage for d1sqka2 (1sqk A:147-371)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488064Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 488065Protein Actin [53073] (6 species)
  7. 488084Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (20 PDB entries)
  8. 488108Domain d1sqka2: 1sqk A:147-371 [105923]
    Other proteins in same PDB: d1sqkb_

Details for d1sqka2

PDB Entry: 1sqk (more details), 2.5 Å

PDB Description: crystal structure of ciboulot in complex with skeletal actin

SCOP Domain Sequences for d1sqka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqka2 c.55.1.1 (A:147-371) Actin {Rabbit (Oryctolagus cuniculus)}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh

SCOP Domain Coordinates for d1sqka2:

Click to download the PDB-style file with coordinates for d1sqka2.
(The format of our PDB-style files is described here.)

Timeline for d1sqka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqka1
View in 3D
Domains from other chains:
(mouse over for more information)
d1sqkb_