Lineage for d1sqjb2 (1sqj B:431-786)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066474Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) (S)
    duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)
  5. 2066475Family b.69.13.1: Oligoxyloglucan reducing end-specific cellobiohydrolase [110297] (2 protein domains)
    contains at least 9 BNR/Asp-box repeats (Pfam PF02012) usually associated with the 6-bladed propeller Neuraminidases (50939)
  6. Protein Oligoxyloglucan reducing end-specific cellobiohydrolase [110298] (1 species)
  7. Species Yeast (Geotrichum sp. M128) [TaxId:203496] [110299] (1 PDB entry)
    Uniprot Q8J0D2
  8. 2066481Domain d1sqjb2: 1sqj B:431-786 [105921]

Details for d1sqjb2

PDB Entry: 1sqj (more details), 2.2 Å

PDB Description: Crystal Structure Analysis of Oligoxyloglucan reducing-end-specific cellobiohydrolase (OXG-RCBH)
PDB Compounds: (B:) oligoxyloglucan reducing-end-specific cellobiohydrolase

SCOPe Domain Sequences for d1sqjb2:

Sequence, based on SEQRES records: (download)

>d1sqjb2 b.69.13.1 (B:431-786) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]}
wapswylqidgieenailslrspksgaallsgigdisgmkhddltkpqkmfgapqfsnld
sidaagnfpnvvvragssgheydsacargayatdggdawtifptcppgmnashyqgstia
vdasgsqivwstkldeqasgpwyshdygktwsvpagdlkaqtanvlsdkvqdgtfyatdg
gkffvstdggksyaakgaglvtgtslmpavnpwvagdvwvpvpegglfhstdfgasftrv
gtanatlvsvgapksksdgkkasapsavfiwgtdkpgsdiglyrsddngstwtrvndqeh
nysgptmieadpkvygrvylgtngrgivyadltnkksneekstakcangqkgthcy

Sequence, based on observed residues (ATOM records): (download)

>d1sqjb2 b.69.13.1 (B:431-786) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]}
wapswylqidgieenailslrspksgaallsgigdisgmkhddltkpqkmfgapqfsnld
sidaagnfpnvvvragssgheydsacargayatdggdawtifptcppgmnashyqgstia
vdasgsqivwstkldeqasgpwyshdygktwsvpagdlkaqtanvlsdkvqdgtfyatdg
gkffvstdggksyaakgaglvtgtslmpavnpwvagdvwvpvpegglfhstdfgasftrv
gtanatlvsvgapkssapsavfiwgtdkpgsdiglyrsddngstwtrvndqehnysgptm
ieadpkvygrvylgtngrgivyadltkstakcangqkgthcy

SCOPe Domain Coordinates for d1sqjb2:

Click to download the PDB-style file with coordinates for d1sqjb2.
(The format of our PDB-style files is described here.)

Timeline for d1sqjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqjb1