Lineage for d1sqjb1 (1sqj B:4-430)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2419123Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) (S)
    duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)
  5. 2419124Family b.69.13.1: Oligoxyloglucan reducing end-specific cellobiohydrolase [110297] (2 proteins)
    contains at least 9 BNR/Asp-box repeats (Pfam PF02012) usually associated with the 6-bladed propeller Neuraminidases (50939)
  6. Protein Oligoxyloglucan reducing end-specific cellobiohydrolase [110298] (1 species)
  7. Species Yeast (Geotrichum sp. M128) [TaxId:203496] [110299] (1 PDB entry)
    Uniprot Q8J0D2
  8. 2419129Domain d1sqjb1: 1sqj B:4-430 [105920]

Details for d1sqjb1

PDB Entry: 1sqj (more details), 2.2 Å

PDB Description: Crystal Structure Analysis of Oligoxyloglucan reducing-end-specific cellobiohydrolase (OXG-RCBH)
PDB Compounds: (B:) oligoxyloglucan reducing-end-specific cellobiohydrolase

SCOPe Domain Sequences for d1sqjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqjb1 b.69.13.1 (B:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]}
yefknvaiggggyitgivahpktkdllyartdiggayrwdagtskwiplndfieaqdmni
mgtesialdpnnpdrlylaqgryvgdewaafyvsedrgqsftiyespfpmgandmgrnng
erlavnpfnsnevwmgtrtegiwkssdraktwtnvtsipdaftngigytsvifdperngt
iyasatapqgmyvthdggvswepvagqpsswlnrttgafpdkkpasiapqpmkvaltpnf
lyvtyadypgpwgvtfgevwrqnrtsgawdditprvgnsspapynnqtfpaggfcglsvd
atnpnrlvvitldrdpgpaldsiylstdagatwkdvtqlsspsnlegnwghptnaarykd
gtpvpwldfnngpqwggygaphgtpgltkfgwwmsavlidpfnpehlmygtgatiwatdt
lsrvekd

SCOPe Domain Coordinates for d1sqjb1:

Click to download the PDB-style file with coordinates for d1sqjb1.
(The format of our PDB-style files is described here.)

Timeline for d1sqjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqjb2