SCOPe 2.05: Domain d1sqjb1: 1sqj B:4-430

Lineage for d1sqjb1 (1sqj B:4-430)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families)
   duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)

5. Family b.69.13.1: Oligoxyloglucan reducing end-specific cellobiohydrolase [110297] (2 proteins)
   contains at least 9 BNR/Asp-box repeats (Pfam PF02012) usually associated with the 6-bladed propeller Neuraminidases (50939)

6. Protein Oligoxyloglucan reducing end-specific cellobiohydrolase [110298] (1 species)
7. Species Yeast (Geotrichum sp. M128) [TaxId:203496] [110299] (1 PDB entry)
   Uniprot Q8J0D2

8. Domain d1sqjb1: 1sqj B:4-430 [105920]

Details for d1sqjb1

PDB Entry: 1sqj, 2.2 Å

PDB Description: Crystal Structure Analysis of Oligoxyloglucan reducing-end-specific cellobiohydrolase (OXG-RCBH)

PDB Compounds: (B:) oligoxyloglucan reducing-end-specific cellobiohydrolase

SCOPe Domain Sequences for d1sqjb1:

Sequence; same for both SEQRES and ATOM records:

>d1sqjb1 b.69.13.1 (B:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]}
yefknvaiggggyitgivahpktkdllyartdiggayrwdagtskwiplndfieaqdmni
mgtesialdpnnpdrlylaqgryvgdewaafyvsedrgqsftiyespfpmgandmgrnng
erlavnpfnsnevwmgtrtegiwkssdraktwtnvtsipdaftngigytsvifdperngt
iyasatapqgmyvthdggvswepvagqpsswlnrttgafpdkkpasiapqpmkvaltpnf
lyvtyadypgpwgvtfgevwrqnrtsgawdditprvgnsspapynnqtfpaggfcglsvd
atnpnrlvvitldrdpgpaldsiylstdagatwkdvtqlsspsnlegnwghptnaarykd
gtpvpwldfnngpqwggygaphgtpgltkfgwwmsavlidpfnpehlmygtgatiwatdt
lsrvekd

Timeline for d1sqjb1:

• d1sqjb1 first appeared in SCOP 1.69
  
• d1sqjb1 appears in SCOPe 2.04
  
• d1sqjb1 appears in SCOPe 2.06
  
• d1sqjb1 appears in the current release, SCOPe 2.08