![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
![]() | Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [256396] (1 PDB entry) Uniprot P32755 |
![]() | Domain d1sqib1: 1sqi B:8-174 [105916] complexed with 869, fe |
PDB Entry: 1sqi (more details), 2.15 Å
SCOPe Domain Sequences for d1sqib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqib1 d.32.1.3 (B:8-174) 4-hydroxyphenylpyruvate dioxygenase, HppD {Norway rat (Rattus norvegicus) [TaxId: 10116]} gpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvshvikqgki vfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivrepwveedk fgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklp
Timeline for d1sqib1: