Lineage for d1sqib1 (1sqi B:8-156)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502238Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 502239Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families) (S)
  5. 502320Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 502356Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species)
  7. 502366Species Human (Homo sapiens) [TaxId:9606] [110878] (1 PDB entry)
  8. 502369Domain d1sqib1: 1sqi B:8-156 [105916]

Details for d1sqib1

PDB Entry: 1sqi (more details), 2.15 Å

PDB Description: Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases

SCOP Domain Sequences for d1sqib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqib1 d.32.1.3 (B:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens)}
gpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvshvikqgki
vfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivrepwveedk
fgkvkfavlqtygdtthtlvekinytgrf

SCOP Domain Coordinates for d1sqib1:

Click to download the PDB-style file with coordinates for d1sqib1.
(The format of our PDB-style files is described here.)

Timeline for d1sqib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqib2