Lineage for d1sqib1 (1sqi B:8-174)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942578Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2942591Species Norway rat (Rattus norvegicus) [TaxId:10116] [256396] (1 PDB entry)
    Uniprot P32755
  8. 2942594Domain d1sqib1: 1sqi B:8-174 [105916]
    complexed with 869, fe

Details for d1sqib1

PDB Entry: 1sqi (more details), 2.15 Å

PDB Description: Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases
PDB Compounds: (B:) 4-hydroxyphenylpyruvic acid dioxygenase

SCOPe Domain Sequences for d1sqib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqib1 d.32.1.3 (B:8-174) 4-hydroxyphenylpyruvate dioxygenase, HppD {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvshvikqgki
vfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivrepwveedk
fgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklp

SCOPe Domain Coordinates for d1sqib1:

Click to download the PDB-style file with coordinates for d1sqib1.
(The format of our PDB-style files is described here.)

Timeline for d1sqib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqib2