SCOPe 2.08: Domain d1sqia1: 1sqi A:8-174

Lineage for d1sqia1 (1sqi A:8-174)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [256396] (1 PDB entry)
   Uniprot P32755

8. Domain d1sqia1: 1sqi A:8-174 [105914]
   complexed with 869, fe

Details for d1sqia1

PDB Entry: 1sqi, 2.15 Å

PDB Description: Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases

PDB Compounds: (A:) 4-hydroxyphenylpyruvic acid dioxygenase

SCOPe Domain Sequences for d1sqia1:

Sequence; same for both SEQRES and ATOM records:

>d1sqia1 d.32.1.3 (A:8-174) 4-hydroxyphenylpyruvate dioxygenase, HppD {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvshvikqgki
vfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivrepwveedk
fgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklp

Timeline for d1sqia1:

• d1sqia1 first appeared in SCOP 1.69
  
• d1sqia1 appears in SCOPe 2.07