![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
![]() | Family c.66.1.38: NOL1/NOP2/sun [102575] (3 proteins) Pfam PF01189; contains additional N-terminal 3-helical and ferredoxin-like domains |
![]() | Protein Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain [110669] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110670] (2 PDB entries) Uniprot P36929 |
![]() | Domain d1sqga2: 1sqg A:145-428 [105913] Other proteins in same PDB: d1sqga1 |
PDB Entry: 1sqg (more details), 1.65 Å
SCOPe Domain Sequences for d1sqga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} hpswllkrlqkaypeqwqsiveannqrppmwlrinrthhsrdswlalldeagmkgfphad ypdavrletpapvhalpgfedgwvtvqdasaqgcmtwlapqngehildlcaapggktthi levapeaqvvavdideqrlsrvydnlkrlgmkatvkqgdgrypsqwcgeqqfdrilldap csatgvirrhpdikwlrrdrdipelaqlqseildaiwphlktggtlvyatcsvlpeensl qikaflqrtadaelcetgtpeqpgkqnlpgaeegdgffyaklik
Timeline for d1sqga2: