Lineage for d1sqga2 (1sqg A:145-428)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893994Family c.66.1.38: NOL1/NOP2/sun [102575] (3 proteins)
    Pfam PF01189; contains additional N-terminal 3-helical and ferredoxin-like domains
  6. 2894001Protein Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain [110669] (1 species)
  7. 2894002Species Escherichia coli [TaxId:562] [110670] (2 PDB entries)
    Uniprot P36929
  8. 2894003Domain d1sqga2: 1sqg A:145-428 [105913]
    Other proteins in same PDB: d1sqga1

Details for d1sqga2

PDB Entry: 1sqg (more details), 1.65 Å

PDB Description: The crystal structure of the E. coli Fmu apoenzyme at 1.65 A resolution
PDB Compounds: (A:) SUN protein

SCOPe Domain Sequences for d1sqga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}
hpswllkrlqkaypeqwqsiveannqrppmwlrinrthhsrdswlalldeagmkgfphad
ypdavrletpapvhalpgfedgwvtvqdasaqgcmtwlapqngehildlcaapggktthi
levapeaqvvavdideqrlsrvydnlkrlgmkatvkqgdgrypsqwcgeqqfdrilldap
csatgvirrhpdikwlrrdrdipelaqlqseildaiwphlktggtlvyatcsvlpeensl
qikaflqrtadaelcetgtpeqpgkqnlpgaeegdgffyaklik

SCOPe Domain Coordinates for d1sqga2:

Click to download the PDB-style file with coordinates for d1sqga2.
(The format of our PDB-style files is described here.)

Timeline for d1sqga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqga1