SCOPe 2.07: Domain d1sqfa2: 1sqf A:145-429

Lineage for d1sqfa2 (1sqf A:145-429)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.38: NOL1/NOP2/sun [102575] (3 proteins)
   Pfam PF01189; contains additional N-terminal 3-helical and ferredoxin-like domains

6. Protein Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain [110669] (1 species)

7. Species Escherichia coli [TaxId:562] [110670] (2 PDB entries)
   Uniprot P36929

8. Domain d1sqfa2: 1sqf A:145-429 [105911]
   Other proteins in same PDB: d1sqfa1
   protein/RNA complex; complexed with sam

Details for d1sqfa2

PDB Entry: 1sqf, 2.1 Å

PDB Description: The crystal structure of E. coli Fmu binary complex with S-Adenosylmethionine at 2.1 A resolution

PDB Compounds: (A:) SUN protein

SCOPe Domain Sequences for d1sqfa2:

Sequence; same for both SEQRES and ATOM records:

>d1sqfa2 c.66.1.38 (A:145-429) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}
hpswllkrlqkaypeqwqsiveannqrppmwlrinrthhsrdswlalldeagmkgfphad
ypdavrletpapvhalpgfedgwvtvqdasaqgcmtwlapqngehildlcaapggktthi
levapeaqvvavdideqrlsrvydnlkrlgmkatvkqgdgrypsqwcgeqqfdrilldap
csatgvirrhpdikwlrrdrdipelaqlqseildaiwphlktggtlvyatcsvlpeensl
qikaflqrtadaelcetgtpeqpgkqnlpgaeegdgffyaklikk

Timeline for d1sqfa2:

• d1sqfa2 first appeared in SCOP 1.69
  
• d1sqfa2 appears in SCOPe 2.06
  
• d1sqfa2 appears in the current release, SCOPe 2.08