Lineage for d1sqfa2 (1sqf A:145-429)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146220Family c.66.1.38: NOL1/NOP2/sun [102575] (3 proteins)
    Pfam PF01189; contains additional N-terminal 3-helical and ferredoxin-like domains
  6. 2146227Protein Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain [110669] (1 species)
  7. 2146228Species Escherichia coli [TaxId:562] [110670] (2 PDB entries)
    Uniprot P36929
  8. 2146230Domain d1sqfa2: 1sqf A:145-429 [105911]
    Other proteins in same PDB: d1sqfa1
    protein/RNA complex; complexed with sam

Details for d1sqfa2

PDB Entry: 1sqf (more details), 2.1 Å

PDB Description: The crystal structure of E. coli Fmu binary complex with S-Adenosylmethionine at 2.1 A resolution
PDB Compounds: (A:) SUN protein

SCOPe Domain Sequences for d1sqfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqfa2 c.66.1.38 (A:145-429) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}
hpswllkrlqkaypeqwqsiveannqrppmwlrinrthhsrdswlalldeagmkgfphad
ypdavrletpapvhalpgfedgwvtvqdasaqgcmtwlapqngehildlcaapggktthi
levapeaqvvavdideqrlsrvydnlkrlgmkatvkqgdgrypsqwcgeqqfdrilldap
csatgvirrhpdikwlrrdrdipelaqlqseildaiwphlktggtlvyatcsvlpeensl
qikaflqrtadaelcetgtpeqpgkqnlpgaeegdgffyaklikk

SCOPe Domain Coordinates for d1sqfa2:

Click to download the PDB-style file with coordinates for d1sqfa2.
(The format of our PDB-style files is described here.)

Timeline for d1sqfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqfa1