| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
| Family c.66.1.38: NOL1/NOP2/sun [102575] (3 proteins) Pfam PF01189; contains additional N-terminal 3-helical and ferredoxin-like domains |
| Protein Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain [110669] (1 species) |
| Species Escherichia coli [TaxId:562] [110670] (2 PDB entries) Uniprot P36929 |
| Domain d1sqfa2: 1sqf A:145-429 [105911] Other proteins in same PDB: d1sqfa1 protein/RNA complex; complexed with sam |
PDB Entry: 1sqf (more details), 2.1 Å
SCOPe Domain Sequences for d1sqfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqfa2 c.66.1.38 (A:145-429) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}
hpswllkrlqkaypeqwqsiveannqrppmwlrinrthhsrdswlalldeagmkgfphad
ypdavrletpapvhalpgfedgwvtvqdasaqgcmtwlapqngehildlcaapggktthi
levapeaqvvavdideqrlsrvydnlkrlgmkatvkqgdgrypsqwcgeqqfdrilldap
csatgvirrhpdikwlrrdrdipelaqlqseildaiwphlktggtlvyatcsvlpeensl
qikaflqrtadaelcetgtpeqpgkqnlpgaeegdgffyaklikk
Timeline for d1sqfa2: