Lineage for d1sqfa1 (1sqf A:5-144)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719091Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 2719092Superfamily a.79.1: NusB-like [48013] (4 families) (S)
  5. 2719122Family a.79.1.3: RmsB N-terminal domain-like [109930] (1 protein)
    automatically mapped to Pfam PF01029
  6. 2719123Protein Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain [109931] (1 species)
  7. 2719124Species Escherichia coli [TaxId:562] [109932] (2 PDB entries)
    Uniprot P36929
  8. 2719126Domain d1sqfa1: 1sqf A:5-144 [105910]
    Other proteins in same PDB: d1sqfa2
    protein/RNA complex; complexed with sam

Details for d1sqfa1

PDB Entry: 1sqf (more details), 2.1 Å

PDB Description: The crystal structure of E. coli Fmu binary complex with S-Adenosylmethionine at 2.1 A resolution
PDB Compounds: (A:) SUN protein

SCOPe Domain Sequences for d1sqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqfa1 a.79.1.3 (A:5-144) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain {Escherichia coli [TaxId: 562]}
rnlrsmaaqaveqvveqgqslsnilpplqqkvsdkdkallqelcfgvlrtlsqldwlink
lmarpmtgkqrtvhylimvglyqllytripphaalaetvegaiaikrpqlkglingvlrq
fqrqqeellaefnasdaryl

SCOPe Domain Coordinates for d1sqfa1:

Click to download the PDB-style file with coordinates for d1sqfa1.
(The format of our PDB-style files is described here.)

Timeline for d1sqfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqfa2