SCOPe 2.08: Domain d1sqfa1: 1sqf A:5-144

Lineage for d1sqfa1 (1sqf A:5-144)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.79: NusB-like [48012] (1 superfamily)
   6 helices: bundle; one central helix is surrounded by 5 others

4. Superfamily a.79.1: NusB-like [48013] (4 families)

5. Family a.79.1.3: RmsB N-terminal domain-like [109930] (1 protein)
   automatically mapped to Pfam PF01029

6. Protein Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain [109931] (1 species)

7. Species Escherichia coli [TaxId:562] [109932] (2 PDB entries)
   Uniprot P36929

8. Domain d1sqfa1: 1sqf A:5-144 [105910]
   Other proteins in same PDB: d1sqfa2
   protein/RNA complex; complexed with sam

Details for d1sqfa1

PDB Entry: 1sqf, 2.1 Å

PDB Description: The crystal structure of E. coli Fmu binary complex with S-Adenosylmethionine at 2.1 A resolution

PDB Compounds: (A:) SUN protein

SCOPe Domain Sequences for d1sqfa1:

Sequence; same for both SEQRES and ATOM records:

>d1sqfa1 a.79.1.3 (A:5-144) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain {Escherichia coli [TaxId: 562]}
rnlrsmaaqaveqvveqgqslsnilpplqqkvsdkdkallqelcfgvlrtlsqldwlink
lmarpmtgkqrtvhylimvglyqllytripphaalaetvegaiaikrpqlkglingvlrq
fqrqqeellaefnasdaryl

Timeline for d1sqfa1:

• d1sqfa1 first appeared in SCOP 1.69
  
• d1sqfa1 appears in SCOPe 2.07