Lineage for d1sqeb_ (1sqe B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861406Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 861497Family d.58.4.5: PG130-like [102959] (5 proteins)
    subfamily of Pfam PF03992
  6. 861509Protein Hypothetical protein PG130 (SAV0165) [110955] (1 species)
  7. 861510Species Staphylococcus aureus [TaxId:1280] [110956] (2 PDB entries)
    Uniprot Q99X56
  8. 861514Domain d1sqeb_: 1sqe B: [105909]
    Structural genomics target

Details for d1sqeb_

PDB Entry: 1sqe (more details), 1.5 Å

PDB Description: 1.5A Crystal Structure Of the protein PG130 from Staphylococcus aureus, Structural genomics
PDB Compounds: (B:) hypothetical protein PG130

SCOP Domain Sequences for d1sqeb_:

Sequence, based on SEQRES records: (download)

>d1sqeb_ d.58.4.5 (B:) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus [TaxId: 1280]}
hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
edsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk

Sequence, based on observed residues (ATOM records): (download)

>d1sqeb_ d.58.4.5 (B:) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus [TaxId: 1280]}
hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
edsfnnwlnsdvfkeavrlksdddgqqspilsnkvfkydigyhyqk

SCOP Domain Coordinates for d1sqeb_:

Click to download the PDB-style file with coordinates for d1sqeb_.
(The format of our PDB-style files is described here.)

Timeline for d1sqeb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sqea_