SCOPe 2.08: Domain d1sqeb1: 1sqe B:17-124

Lineage for d1sqeb1 (1sqe B:17-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (6 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein PG130 (SAV0165) [110955] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110956] (7 PDB entries)
   Uniprot Q99X56

8. Domain d1sqeb1: 1sqe B:17-124 [105909]
   Other proteins in same PDB: d1sqea2, d1sqeb2
   Structural genomics target

Details for d1sqeb1

PDB Entry: 1sqe, 1.5 Å

PDB Description: 1.5A Crystal Structure Of the protein PG130 from Staphylococcus aureus, Structural genomics

PDB Compounds: (B:) hypothetical protein PG130

SCOPe Domain Sequences for d1sqeb1:

Sequence, based on SEQRES records:

>d1sqeb1 d.58.4.5 (B:17-124) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus [TaxId: 1280]}
mfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwese
dsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk

Sequence, based on observed residues (ATOM records):

>d1sqeb1 d.58.4.5 (B:17-124) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus [TaxId: 1280]}
mfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwese
dsfnnwlnsdvfkeavrlksdddgqqspilsnkvfkydigyhyqk

Timeline for d1sqeb1:

• d1sqeb1 first appeared in SCOP 1.69, called d1sqeb_
  
• d1sqeb1 appears in SCOPe 2.07