SCOP 1.69: Domain d1sqea_: 1sqe A:

Lineage for d1sqea_ (1sqe A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (11 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (3 proteins)
   subfamily of Pfam 03992

6. Protein Hypothetical protein PG130 (SAV0165) [110955] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110956] (1 PDB entry)

8. Domain d1sqea_: 1sqe A: [105908]

Details for d1sqea_

PDB Entry: 1sqe, 1.5 Å

PDB Description: 1.5A Crystal Structure Of the protein PG130 from Staphylococcus aureus, Structural genomics

SCOP Domain Sequences for d1sqea_:

Sequence, based on SEQRES records:

>d1sqea_ d.58.4.5 (A:) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus}
hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
edsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk

Sequence, based on observed residues (ATOM records):

>d1sqea_ d.58.4.5 (A:) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus}
hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
edsfnnwlnsdvfkeahddgqqspilsnkvfkydigyhyqk

Timeline for d1sqea_:

• d1sqea_ is new in SCOP 1.69
  
• d1sqea_ appears in SCOP 1.71
  
• d1sqea_ appears in the current release, SCOPe 2.08, called d1sqea1