Lineage for d1sqea1 (1sqe A:17-124)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949820Family d.58.4.5: PG130-like [102959] (6 proteins)
    subfamily of Pfam PF03992
  6. 2949832Protein Hypothetical protein PG130 (SAV0165) [110955] (1 species)
  7. 2949833Species Staphylococcus aureus [TaxId:1280] [110956] (7 PDB entries)
    Uniprot Q99X56
  8. 2949836Domain d1sqea1: 1sqe A:17-124 [105908]
    Other proteins in same PDB: d1sqea2, d1sqeb2
    Structural genomics target

Details for d1sqea1

PDB Entry: 1sqe (more details), 1.5 Å

PDB Description: 1.5A Crystal Structure Of the protein PG130 from Staphylococcus aureus, Structural genomics
PDB Compounds: (A:) hypothetical protein PG130

SCOPe Domain Sequences for d1sqea1:

Sequence, based on SEQRES records: (download)

>d1sqea1 d.58.4.5 (A:17-124) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus [TaxId: 1280]}
mfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwese
dsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk

Sequence, based on observed residues (ATOM records): (download)

>d1sqea1 d.58.4.5 (A:17-124) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus [TaxId: 1280]}
mfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwese
dsfnnwlnsdvfkeahddgqqspilsnkvfkydigyhyqk

SCOPe Domain Coordinates for d1sqea1:

Click to download the PDB-style file with coordinates for d1sqea1.
(The format of our PDB-style files is described here.)

Timeline for d1sqea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqea2