SCOP 1.69: Domain d1sqda1: 1sqd A:14-180

Lineage for d1sqda1 (1sqd A:14-180)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [110877] (4 PDB entries)

8. Domain d1sqda1: 1sqd A:14-180 [105906]

Details for d1sqda1

PDB Entry: 1sqd, 1.8 Å

PDB Description: structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases

SCOP Domain Sequences for d1sqda1:

Sequence, based on SEQRES records:

>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana)}
knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd
lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs
isvangaipssppivlneavtiaevklygdvvlryvsykaedtekse

Sequence, based on observed residues (ATOM records):

>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana)}
knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd
lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs
isvangaipssppivlneavtiaevklygdvvlryvsykae

Timeline for d1sqda1:

• d1sqda1 is new in SCOP 1.69
  
• d1sqda1 appears in SCOP 1.71
  
• d1sqda1 appears in the current release, SCOPe 2.08