![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
![]() | Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (16 PDB entries) Uniprot P93836 33-428 ! Uniprot P93836 63-459 |
![]() | Domain d1sqda1: 1sqd A:14-195 [105906] complexed with fe |
PDB Entry: 1sqd (more details), 1.8 Å
SCOPe Domain Sequences for d1sqda1:
Sequence, based on SEQRES records: (download)
>d1sqda1 d.32.1.3 (A:14-195) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs isvangaipssppivlneavtiaevklygdvvlryvsykaedtekseflpgfervedass fp
>d1sqda1 d.32.1.3 (A:14-195) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs isvangaipssppivlneavtiaevklygdvvlryvsykaeflpgfervedassfp
Timeline for d1sqda1: