Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries) Uniprot P00129 |
Domain d1sqbf_: 1sqb F: [105900] Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_ complexed with azo, fes, hem |
PDB Entry: 1sqb (more details), 2.69 Å
SCOPe Domain Sequences for d1sqbf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqbf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
Timeline for d1sqbf_: