SCOP 1.69: Domain d1sqbe2: 1sqb E:1-69

Lineage for d1sqbe2 (1sqb E:1-69)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81497] (12 PDB entries)

8. Domain d1sqbe2: 1sqb E:1-69 [105899]
   Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_

Details for d1sqbe2

PDB Entry: 1sqb, 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin

SCOP Domain Sequences for d1sqbe2:

Sequence; same for both SEQRES and ATOM records:

>d1sqbe2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus)}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

Timeline for d1sqbe2:

• d1sqbe2 is new in SCOP 1.69
  
• d1sqbe2 appears in SCOP 1.71
  
• d1sqbe2 appears in the current release, SCOPe 2.08