Lineage for d1sqbc1 (1sqb C:261-379)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060751Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1060752Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 1060753Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1060754Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 1060772Species Cow (Bos taurus) [TaxId:9913] [81643] (17 PDB entries)
    Uniprot P00157
  8. 1060784Domain d1sqbc1: 1sqb C:261-379 [105894]
    Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_
    complexed with azo, fes, hem

Details for d1sqbc1

PDB Entry: 1sqb (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1sqbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqbc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOPe Domain Coordinates for d1sqbc1:

Click to download the PDB-style file with coordinates for d1sqbc1.
(The format of our PDB-style files is described here.)

Timeline for d1sqbc1: