Lineage for d1sq9a_ (1sq9 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469053Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 469115Superfamily b.69.4: WD40 repeat-like [50978] (2 families) (S)
    also contains 8-bladed propellers
  5. 469116Family b.69.4.1: WD40-repeat [50979] (8 proteins)
  6. 469130Protein Antiviral protein Ski8 (Ski8p) [110287] (1 species)
  7. 469131Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110288] (1 PDB entry)
  8. 469132Domain d1sq9a_: 1sq9 A: [105889]

Details for d1sq9a_

PDB Entry: 1sq9 (more details), 1.9 Å

PDB Description: structure of ski8p, a wd repeat protein involved in mrna degradation and meiotic recombination

SCOP Domain Sequences for d1sq9a_:

Sequence, based on SEQRES records: (download)

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae)}
kvfiatanagkahdadifsvsacnsftvscsgdgylkvwdnklldnenpkdksyshfvhk
sglhhvdvlqaierdafelclvattsfsgdllfyritredetkkvifekldlldsdmkkh
sfwalkwgasndrllshrlvatdvkgttyiwkfhpfadesnsltlnwsptlelqgtvesp
mtpsqfatsvdisergliatgfnngtvqiselstlrplynfesqhsminnsnsirsvkfs
pqgsllaiahdsnsfgcitlyetefgerigslsvpthssqaslgefahsswvmslsfnds
getlcsagwdgklrfwdvktkerittlnmhcddieieedilavdehgdslaepgvfdvkf
lkkgwrsgmgadlneslccvcldrsirwfreag

Sequence, based on observed residues (ATOM records): (download)

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae)}
kvfiatanagkahdadifsvsacnsftvscsgdgylkvwdnklldnenpkdksyshfvhk
sglhhvdvlqaierdafelclvattsfsgdllfyritredetkkvifekldlldsdmkkh
sfwalkwgasnshrlvatdvkgttyiwkfhpfadesnsltlnwsptlelqgtvespmtps
qfatsvdisergliatgfnngtvqiselstlrplynfesqhnnsnsirsvkfspqgslla
iahdsnsfgcitlyetefgerigslsvpgefahsswvmslsfndsgetlcsagwdgklrf
wdvktkerittlnmhcddieieedilavdehgdslaepgvfdvkflkkgwrsgmgadlne
slccvcldrsirwfreag

SCOP Domain Coordinates for d1sq9a_:

Click to download the PDB-style file with coordinates for d1sq9a_.
(The format of our PDB-style files is described here.)

Timeline for d1sq9a_: