SCOPe 2.07: Domain d1sq8a_: 1sq8 A:

Lineage for d1sq8a_ (1sq8 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)

7. Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
   Uniprot P16117 10-62; contains a short additional helix at C-terminus

8. Domain d1sq8a_: 1sq8 A: [105888]
   design mutant devoid of hydroxyl groups

Details for d1sq8a_

PDB Entry: 1sq8

PDB Description: a variant 434 repressor dna binding domain devoid of hydroxyl groups, nmr, 20 structures

PDB Compounds: (A:) dh434

SCOPe Domain Sequences for d1sq8a_:

Sequence; same for both SEQRES and ATOM records:

>d1sq8a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
mlmgerirarriqlglnqaelaqkvgvdqqaieqlengkakrprflpelaralgvavdwl
lnga

Timeline for d1sq8a_:

• d1sq8a_ first appeared in SCOP 1.69
  
• d1sq8a_ appears in SCOPe 2.06
  
• d1sq8a_ appears in the current release, SCOPe 2.08