![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) ![]() |
![]() | Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
![]() | Protein 434 C1 repressor, DNA-binding domain [47422] (1 species) |
![]() | Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries) |
![]() | Domain d1sq8a_: 1sq8 A: [105888] design mutant devoid of hydroxyl groups |
PDB Entry: 1sq8 (more details)
SCOP Domain Sequences for d1sq8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sq8a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434} mlmgerirarriqlglnqaelaqkvgvdqqaieqlengkakrprflpelaralgvavdwl lnga
Timeline for d1sq8a_: