Lineage for d1sq8a_ (1sq8 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537276Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 537277Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)
  7. 537278Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
  8. 537289Domain d1sq8a_: 1sq8 A: [105888]
    design mutant devoid of hydroxyl groups

Details for d1sq8a_

PDB Entry: 1sq8 (more details)

PDB Description: a variant 434 repressor dna binding domain devoid of hydroxyl groups, nmr, 20 structures

SCOP Domain Sequences for d1sq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sq8a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434}
mlmgerirarriqlglnqaelaqkvgvdqqaieqlengkakrprflpelaralgvavdwl
lnga

SCOP Domain Coordinates for d1sq8a_:

Click to download the PDB-style file with coordinates for d1sq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1sq8a_: