Lineage for d1sq5d_ (1sq5 D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484078Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (5 proteins)
  6. 484085Protein Pantothenate kinase PanK [52587] (1 species)
    has a circularly permuted fold compared to the phosphoribulokinase fold
  7. 484086Species Escherichia coli [TaxId:562] [52588] (3 PDB entries)
  8. 484090Domain d1sq5d_: 1sq5 D: [105885]

Details for d1sq5d_

PDB Entry: 1sq5 (more details), 2.2 Å

PDB Description: Crystal Structure of E. coli Pantothenate kinase

SCOP Domain Sequences for d1sq5d_:

Sequence, based on SEQRES records: (download)

>d1sq5d_ c.37.1.6 (D:) Pantothenate kinase PanK {Escherichia coli}
mtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyiss
nlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittdg
flhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdk
tvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfr
egaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanha
veevrlrk

Sequence, based on observed residues (ATOM records): (download)

>d1sq5d_ c.37.1.6 (D:) Pantothenate kinase PanK {Escherichia coli}
mtpylqfdrnqwaalrdmtlsedeiarlkginedlsleevaeiylplsrllnfyissnlr
rqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittdgflh
pnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdktvv
pdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfregaf
tdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhaveev
rlrk

SCOP Domain Coordinates for d1sq5d_:

Click to download the PDB-style file with coordinates for d1sq5d_.
(The format of our PDB-style files is described here.)

Timeline for d1sq5d_: